, ,
, ,
, ,
, ,
Loading...
Loading...
{
"latency": 53,
"ipAddresses": [
"blogspot.l.googleusercontent.com.",
"142.251.16.132",
"blogspot.l.googleusercontent.com.",
"2607:f8b0:4004:c0b::84"
],
"dns": {
"NS": [
"blogspot.l.googleusercontent.com."
],
"A": [
"blogspot.l.googleusercontent.com.",
"142.251.16.132"
],
"AAAA": [
"blogspot.l.googleusercontent.com.",
"2607:f8b0:4004:c0b::84"
],
"CNAME": [
"blogspot.l.googleusercontent.com."
],
"TXT": [
"logspot.l.googleusercontent.com"
]
}
}
[
{
"url": "https://maltepeevdenevenakliyefirmasi.blogspot.com",
"technologies": [
{
"slug": "opengse",
"name": "OpenGSE",
"versions": [],
"trafficRank": 0,
"confirmedAt": 1723526671,
"icon": "Google.svg",
"categories": [
{
"id": 22,
"slug": "web-servers",
"name": "Web servers"
}
]
},
{
"slug": "clipboard-js",
"name": "Clipboard.js",
"versions": [],
"trafficRank": 0,
"confirmedAt": 1723526671,
"icon": "Clipboard.js.svg",
"categories": [
{
"id": 59,
"slug": "javascript-libraries",
"name": "JavaScript libraries"
}
]
},
{
"slug": "java",
"name": "Java",
"versions": [],
"trafficRank": 0,
"confirmedAt": 1723526671,
"icon": "Java.svg",
"categories": [
{
"id": 27,
"slug": "programming-languages",
"name": "Programming languages"
}
]
},
{
"slug": "blogger",
"name": "Blogger",
"versions": [],
"trafficRank": 0,
"confirmedAt": 1723526671,
"icon": "Blogger.png",
"categories": [
{
"id": 11,
"slug": "blogs",
"name": "Blogs"
}
]
},
{
"slug": "http-3",
"name": "HTTP/3",
"versions": [],
"trafficRank": 0,
"confirmedAt": 1723526671,
"icon": "HTTP3.svg",
"categories": [
{
"id": 19,
"slug": "miscellaneous",
"name": "Miscellaneous"
}
]
},
{
"slug": "python",
"name": "Python",
"versions": [],
"trafficRank": 0,
"confirmedAt": 1723526671,
"icon": "Python.svg",
"categories": [
{
"id": 27,
"slug": "programming-languages",
"name": "Programming languages"
}
]
}
]
}
]
{
"status": 200,
"statusText": "",
"headers": {
"alt-svc": "h3=\":443\"; ma=2592000,h3-29=\":443\"; ma=2592000",
"cache-control": "private, max-age=0",
"content-encoding": "gzip",
"content-type": "text/html; charset=UTF-8",
"date": "Fri, 14 Mar 2025 01:25:34 GMT",
"etag": "W/\"403ef2b1e1bc863705f1103ad709861c8206e5d30193da49619c6410777830f8\"",
"expires": "Fri, 14 Mar 2025 01:25:34 GMT",
"last-modified": "Sat, 05 Oct 2024 04:07:36 GMT",
"server": "GSE",
"transfer-encoding": "chunked",
"x-content-type-options": "nosniff",
"x-robots-tag": "all,noodp",
"x-xss-protection": "1; mode=block"
}
}
{
"OFFSET": "An imagery resource from Shutterstock.",
"Google Identity Platform": "Google Sign-In is a secure authentication system that enables users to sign in with their Google account.",
"Organization Schema": "Organization i.e. school, NGO, Corporation.",
"Person Schema": "A human being.",
"IPhone / Mobile Compatible": "The website contains code that allows the page to support IPhone / Mobile Content.",
"Viewport Meta": "This page uses the viewport meta tag which means the content may be optimized for mobile content.",
"GStatic Google Static Content": "Google has off-loaded static content (Javascript/Images/CSS) to a different domain name in an effort to reduce bandwidth usage and increase network performance for the end user.",
"Google Maps": "Google maps embedded into the webpage.",
"Blogger": "Google Blogger Software.",
"Google API": "The website uses some form of Google APIs to provide interaction with the many API's Google Providers.",
"Lightbox": "Lightbox JS is a simple, unobtrusive script used to overlay images on the current page. It's a snap to setup and works on all modern browsers.",
"Google Servlet Engine": "Google Servlet Engine released as OpenGSE.",
"HTML5 DocType": "The DOCTYPE is a required preamble for HTML5 websites.",
"Font Face Rule": "The @font-face rule allows for linking to fonts that are automatically activated when needed.",
"HTML 5 Specific Tags": "This page contains tags that are specific to an HTML 5 implementation.",
"WAI-ARIA": "A way to make Web content and Web applications more accessible to people with disabilities. It especially helps with dynamic content and advanced user interface controls developed with Ajax, HTML, JavaScript, and related technologies.",
"JSON-LD": "JSON-LD, or JavaScript Object Notation for Linked Data, is a method of transporting Linked Data using JSON.",
"Javascript": "JavaScript is a scripting language most often used for client-side web development.",
"Meta Robot": "This page contains a meta robots tag which tells search engines and robots to index or not index the page.",
"Content Type Options": "Used to disable MIME-sniffing for a particular HTTP response.",
"X-XSS-Protection": "X-XSS-Protection is a HTTP header set by Internet Explorer 8+. This header lets domains toggle on and off the \"XSS Filter\" of IE8, which prevents some categories of XSS attacks.",
"HTTP3 Alt-Svc": "HTTP3 support test via the Alt-Svc HTTP header."
}
{
"data": {
"total": 0,
"personal_emails": 0,
"generic_emails": 0,
"department": {
"executive": 0,
"it": 0,
"finance": 0,
"management": 0,
"sales": 0,
"legal": 0,
"support": 0,
"hr": 0,
"marketing": 0,
"communication": 0,
"education": 0,
"design": 0,
"health": 0,
"operations": 0
},
"seniority": {
"junior": 0,
"senior": 0,
"executive": 0
}
},
"meta": {
"params": {
"domain": "maltepeevdenevenakliyefirmasi.blogspot.com",
"company": null,
"type": null
}
}
}
User-agent: Mediapartners-Google
User-agent: *
Disallow: /search?q=*
Disallow: /*?updated-max=*
Allow: /
Sitemap: https://maltepeevdenevenakliyefirmasi.blogspot.com/atom.xml?redirect=false&start-index=1&max-results=500
{
"error": false,
"result": {
"success": true,
"author": "Maltepe Evden Eve Nakliyat",
"ogTitle": "Maltepe Evden Eve Nakliyat",
"ogDescription": "Maltepe Evden Eve Nakliyat firması denince akla biz geliyoruz. Çünkü işimizi iyi yapıyoruz.",
"ogImage": [
{
"url": "https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEiUVU_W8VK2QAgLmg2R9Xsv2k0nwGjuoa2YAOvDsSPpGIueW_X1sAVEf4e1ksf1zwBHoMRRPj7WVJBbISTcu8TgHFd9olU1W9VR0a8cIFFM4JmRfnYOjguKFPeBkGnZU8PgnMY52ODjNMg/w400-h266/umraniye-evden-eve-nakliyat.jpg",
"type": "jpg"
},
{
"url": "https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEiiB_KD7W7Y9TFZQFpeIxmstXFpFS9khGSMbpOcdo1sqpgFzg8dBYiwa8cnMtp9gEiAkfZUJ6owDWXymCpx8xPwAcJvzTQSFKHNSIl93lSbV3BmNNRHG6zv9w3UY96uxkUiNoo2bQCFetA/w501-h334/esya-depolama.jpg",
"type": "jpg"
},
{
"url": "https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEglSpujIQHxqvPv_PhSCHTk15Ai68_5l9Y8wMXOz77NMs6VremceW7-OVuup_pVrBfy6VFM0fPw9_Oxkj_TUsQRrJ8T72mNsRh1W8wQ8mnRQBePBWYfyHi2Iu4lEHGIsclNMfj2hXxJHfY/s1600/Sancaktepe+Evden+Eve+Nakliyat.jpg",
"type": "jpg"
},
{
"url": "https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEgmmGNYgZWIV0ADWsnuDP0mpYvydZ-KKGDcPf80KnD8IZoviW6jorZGSMK_WOXi1-m6OtmfiGxmz_hyTJnj0Ip4lWxFPucV_f-ZpC1_7KM43AZ7BgE2YpSEZv2-1Au3Xh-2wjGouM5hWjQ/s400/soganlik-yeni-mahalle-evden-eve-nakliyat.jpg",
"type": "jpg"
},
{
"url": "https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEizoSMV-YTGpbGxTRLrtKpTJyRSsMSqX5a3U2A25plCNTyrWcyzGIVrVrSrVoNHK1EE9zDIVvasFeO8ymbjIxu4sMmk_rAVKvwUINk2snuQF82-eSriYxVHvwrEolqEo_3d4yYfyqYnu-g/s400/yunus-mahallesi-evden-eve-nakliyat.jpg",
"type": "jpg"
}
],
"ogDate": "2020-12-24T00:05:00-08:00",
"charset": "UTF-8",
"jsonLD": [
{
"@context": "http://schema.org",
"@type": "BlogPosting",
"mainEntityOfPage": {
"@type": "WebPage",
"@id": "https://maltepeevdenevenakliyefirmasi.blogspot.com/2020/08/esya-depolama.html"
},
"headline": "Eşya Depolama",
"description": "Eşya depolama hizmeti eşya depolama firmaları tarafından verilen mekânsal depolama hizmeti desteğidir. Geniş yer kaplayan büyük eşyaların uz...",
"datePublished": "2020-08-25T02:37:00-07:00",
"dateModified": "2020-08-25T02:37:49-07:00",
"image": {
"@type": "ImageObject",
"url": "https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEiiB_KD7W7Y9TFZQFpeIxmstXFpFS9khGSMbpOcdo1sqpgFzg8dBYiwa8cnMtp9gEiAkfZUJ6owDWXymCpx8xPwAcJvzTQSFKHNSIl93lSbV3BmNNRHG6zv9w3UY96uxkUiNoo2bQCFetA/w1200-h630-p-k-no-nu/esya-depolama.jpg",
"height": 630,
"width": 1200
},
"publisher": {
"@type": "Organization",
"name": "Blogger",
"logo": {
"@type": "ImageObject",
"url": "https://blogger.googleusercontent.com/img/b/U2hvZWJveA/AVvXsEgfMvYAhAbdHksiBA24JKmb2Tav6K0GviwztID3Cq4VpV96HaJfy0viIu8z1SSw_G9n5FQHZWSRao61M3e58ImahqBtr7LiOUS6m_w59IvDYwjmMcbq3fKW4JSbacqkbxTo8B90dWp0Cese92xfLMPe_tg11g/h60/",
"width": 206,
"height": 60
}
},
"author": {
"@type": "Person",
"name": "Aslıhan Özgür"
}
},
{
"@context": "http://schema.org",
"@type": "BlogPosting",
"mainEntityOfPage": {
"@type": "WebPage",
"@id": "https://maltepeevdenevenakliyefirmasi.blogspot.com/2020/02/sancaktepe-evden-eve-nakliyat.html"
},
"headline": "Sancaktepe Evden Eve Nakliyat",
"description": "Ev taşıma işlemleri gerçekleştirilirken dikkat edilmesi gereken belli başlı konular vardır. Eşyaların en az şekilde hasar görmesi h...",
"datePublished": "2020-02-11T01:33:00-08:00",
"dateModified": "2020-02-27T14:06:20-08:00",
"image": {
"@type": "ImageObject",
"url": "https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEglSpujIQHxqvPv_PhSCHTk15Ai68_5l9Y8wMXOz77NMs6VremceW7-OVuup_pVrBfy6VFM0fPw9_Oxkj_TUsQRrJ8T72mNsRh1W8wQ8mnRQBePBWYfyHi2Iu4lEHGIsclNMfj2hXxJHfY/w1200-h630-p-k-no-nu/Sancaktepe+Evden+Eve+Nakliyat.jpg",
"height": 630,
"width": 1200
},
"publisher": {
"@type": "Organization",
"name": "Blogger",
"logo": {
"@type": "ImageObject",
"url": "https://blogger.googleusercontent.com/img/b/U2hvZWJveA/AVvXsEgfMvYAhAbdHksiBA24JKmb2Tav6K0GviwztID3Cq4VpV96HaJfy0viIu8z1SSw_G9n5FQHZWSRao61M3e58ImahqBtr7LiOUS6m_w59IvDYwjmMcbq3fKW4JSbacqkbxTo8B90dWp0Cese92xfLMPe_tg11g/h60/",
"width": 206,
"height": 60
}
},
"author": {
"@type": "Person",
"name": "Aslıhan Özgür"
}
},
{
"@context": "http://schema.org",
"@type": "BlogPosting",
"mainEntityOfPage": {
"@type": "WebPage",
"@id": "https://maltepeevdenevenakliyefirmasi.blogspot.com/2019/12/soganlik-yeni-mahalle-evden-eve-nakliyat.html"
},
"headline": "Soğanlık Yeni Mahalle Evden Eve Nakliyat",
"description": "Evden eve nakliyat yapılacağı zaman insanların da aslında evde bir telaşı başlamaktadır. Burada nakliyat hizmetini ne kadar önemli o...",
"datePublished": "2019-12-17T09:36:00-08:00",
"dateModified": "2019-12-17T09:36:12-08:00",
"image": {
"@type": "ImageObject",
"url": "https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEgmmGNYgZWIV0ADWsnuDP0mpYvydZ-KKGDcPf80KnD8IZoviW6jorZGSMK_WOXi1-m6OtmfiGxmz_hyTJnj0Ip4lWxFPucV_f-ZpC1_7KM43AZ7BgE2YpSEZv2-1Au3Xh-2wjGouM5hWjQ/w1200-h630-p-k-no-nu/soganlik-yeni-mahalle-evden-eve-nakliyat.jpg",
"height": 630,
"width": 1200
},
"publisher": {
"@type": "Organization",
"name": "Blogger",
"logo": {
"@type": "ImageObject",
"url": "https://blogger.googleusercontent.com/img/b/U2hvZWJveA/AVvXsEgfMvYAhAbdHksiBA24JKmb2Tav6K0GviwztID3Cq4VpV96HaJfy0viIu8z1SSw_G9n5FQHZWSRao61M3e58ImahqBtr7LiOUS6m_w59IvDYwjmMcbq3fKW4JSbacqkbxTo8B90dWp0Cese92xfLMPe_tg11g/h60/",
"width": 206,
"height": 60
}
},
"author": {
"@type": "Person",
"name": "Aslıhan Özgür"
}
},
{
"@context": "http://schema.org",
"@type": "BlogPosting",
"mainEntityOfPage": {
"@type": "WebPage",
"@id": "https://maltepeevdenevenakliyefirmasi.blogspot.com/2019/12/yunus-mahallesi-evden-eve-nakliyat.html"
},
"headline": "Yunus Mahallesi Evden Eve Nakliyat",
"description": "              Evden eve nakliyat hizmeti yapılırken ekip ve ekipman gerçekten de çok önemli. Günümüzde insanlar çok daha kaliteli hizmet...",
"datePublished": "2019-12-10T07:26:00-08:00",
"dateModified": "2020-12-24T00:00:58-08:00",
"image": {
"@type": "ImageObject",
"url": "https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEizoSMV-YTGpbGxTRLrtKpTJyRSsMSqX5a3U2A25plCNTyrWcyzGIVrVrSrVoNHK1EE9zDIVvasFeO8ymbjIxu4sMmk_rAVKvwUINk2snuQF82-eSriYxVHvwrEolqEo_3d4yYfyqYnu-g/w1200-h630-p-k-no-nu/yunus-mahallesi-evden-eve-nakliyat.jpg",
"height": 630,
"width": 1200
},
"publisher": {
"@type": "Organization",
"name": "Blogger",
"logo": {
"@type": "ImageObject",
"url": "https://blogger.googleusercontent.com/img/b/U2hvZWJveA/AVvXsEgfMvYAhAbdHksiBA24JKmb2Tav6K0GviwztID3Cq4VpV96HaJfy0viIu8z1SSw_G9n5FQHZWSRao61M3e58ImahqBtr7LiOUS6m_w59IvDYwjmMcbq3fKW4JSbacqkbxTo8B90dWp0Cese92xfLMPe_tg11g/h60/",
"width": 206,
"height": 60
}
},
"author": {
"@type": "Person",
"name": "Aslıhan Özgür"
}
}
],
"requestUrl": "https://maltepeevdenevenakliyefirmasi.blogspot.com"
},
"response": {}
}
{
"whois.verisign-grs.com": {
"Domain Status": [],
"Name Server": [],
">>> Last update of whois database": "2025-03-14T01:25:26Z <<<",
"text": [
"No match for \"MALTEPEEVDENEVENAKLIYEFIRMASI.BLOGSPOT.COM\".",
"",
"NOTICE: The expiration date displayed in this record is the date the",
"registrar's sponsorship of the domain name registration in the registry is",
"currently set to expire. This date does not necessarily reflect the expiration",
"date of the domain name registrant's agreement with the sponsoring",
"registrar. Users may consult the sponsoring registrar's Whois database to",
"view the registrar's reported date of expiration for this registration.",
"",
"TERMS OF USE: You are not authorized to access or query our Whois",
"database through the use of electronic processes that are high-volume and",
"automated except as reasonably necessary to register domain names or",
"modify existing registrations; the Data in VeriSign Global Registry",
"Services' (\"VeriSign\") Whois database is provided by VeriSign for",
"information purposes only, and to assist persons in obtaining information",
"about or related to a domain name registration record. VeriSign does not",
"guarantee its accuracy. By submitting a Whois query, you agree to abide",
"by the following terms of use: You agree that you may use this Data only",
"for lawful purposes and that under no circumstances will you use this Data",
"to: (1) allow, enable, or otherwise support the transmission of mass",
"unsolicited, commercial advertising or solicitations via e-mail, telephone,",
"or facsimile; or (2) enable high volume, automated, electronic processes",
"that apply to VeriSign (or its computer systems). The compilation,",
"repackaging, dissemination or other use of this Data is expressly",
"prohibited without the prior written consent of VeriSign. You agree not to",
"use electronic processes that are automated and high-volume to access or",
"query the Whois database except as reasonably necessary to register",
"domain names or modify existing registrations. VeriSign reserves the right",
"to restrict your access to the Whois database in its sole discretion to ensure",
"operational stability. VeriSign may restrict or terminate your access to the",
"Whois database for failure to abide by these terms of use. VeriSign",
"reserves the right to modify these terms at any time.",
"",
"The Registry database contains ONLY .COM, .NET, .EDU domains and",
"Registrars."
]
}
}